PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01769.1.g00170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 289aa    MW: 31657.6 Da    PI: 7.2532
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01769.1.g00170.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding301.2e-093985347
                                    SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
                 Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                                     WTteE + + +a ++   +   +W+++a++++  +t  ++ ++++++
  Zmw_sc01769.1.g00170.1.sm.mkhc 39 TWTTEENKVFEKALALIDRNapdRWEKVAAMLP-SKTVADVMNHYNDL 85
                                    7*****************99*************.***********986 PP

2Myb_DNA-binding44.53.5e-14144188347
                                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                 Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                     +WT++E++l++ + k++G g+W+ I+r + ++Rt+ q+ s+ qky
  Zmw_sc01769.1.g00170.1.sm.mkhc 144 PWTEDEHKLFLLGLKKYGRGDWRNISRNFVTTRTPTQVASHAQKY 188
                                     8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.6283589IPR017884SANT domain
SMARTSM007175.2E-83688IPR001005SANT/Myb domain
SuperFamilySSF466894.59E-113892IPR009057Homeodomain-like
PfamPF002492.5E-73985IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-43985IPR009057Homeodomain-like
CDDcd001674.23E-73985No hitNo description
PROSITE profilePS5129417.105137193IPR017930Myb domain
SuperFamilySSF466892.44E-17139193IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-17140191IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.0E-11141187IPR009057Homeodomain-like
SMARTSM007172.3E-12141191IPR001005SANT/Myb domain
PfamPF002491.0E-11144188IPR001005SANT/Myb domain
CDDcd001677.06E-11144189No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MMAEMWTQML LPTLGSCFAG QSWWPWLDRH AGSGGGGDTW TTEENKVFEK ALALIDRNAP  60
DRWEKVAAML PSKTVADVMN HYNDLENDVG FIEAGLVPFP HYSSSPPASG FTLDYWDGSD  120
GVFRRGCCLK RGRGPDQERK KGVPWTEDEH KLFLLGLKKY GRGDWRNISR NFVTTRTPTQ  180
VASHAQKYFI RLNSGGKDKR RSSIHDITTA NLPLPDDSHG GNASPSPSSA LTTASNPAGA  240
ADQFGTLSDV KPFMPPFPGV SHPYANVKLE PTSSLASGLG FDGNVLLQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1631105276RADIALIS
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970612.11e-145PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H79e-76DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLK3XKK01e-145K3XKK0_SETIT; Uncharacterized protein
STRINGSi002423m1e-144(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796